| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MTR |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. Recommended conditions for IHC,Retrieval method: HIER pH6 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MTR Antibody from Novus Biologicals is a rabbit polyclonal antibody to MTR. This antibody reacts with human. The MTR Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DIGKNIVGVVLGCNNFRVIDLGVMTPCDKILKAALDHKADIIGLSGLITPSLDEMIFVAKEMERLAIRIPLLI |
|---|
| Other Names | 5-methyltetrahydrofolate-homocysteine methyltransferase, 5-methyltetrahydrofolate-homocysteine methyltransferase 1, cblG, cobalamin-dependent methionine synthase, EC 2.1.1.13, FLJ33168, FLJ43216,5-methyltetrahydrofolate--homocysteine methyltransferase, FLJ45386, methionine synthase, MS, Vitamin-B12 dependent methionine synthase |
|---|
| Gene, Accession # | MTR, Gene ID: 4548 |
|---|
| Catalog # | NBP2-68713 |
|---|
| Price | |
|---|
| Order / More Info | MTR Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|