| 产品详情 |
| Edit |   |
| Antigenic Specificity | CXCR2/IL-8RB |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CXCR2/IL-8RB Antibody from Novus Biologicals is a rabbit polyclonal antibody to CXCR2/IL-8RB. This antibody reacts with human. The CXCR2/IL-8RB Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CXCR2/IL-8 RB antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINK |
| Other Names | CD182 antigen, CDw128b, chemokine (C-X-C motif) receptor 2, chemokine (CXC) receptor 2, C-X-C chemokine receptor type 2, CXC-R2, CXCR-2, CXCR2 gene for IL8 receptor type B, GRO/MGSA receptor, High affinity interleukin-8 receptor B, IL-8 receptor type 2, IL-8R B, IL8R2, IL8RA, interleukin 8 receptor B, interleukin 8 receptor type 2, interleukin-8 receptor type B |
| Gene, Accession # | CXCR2, Gene ID: 3579, Accession: P25025, SwissProt: P25025 |
| Catalog # | NBP2-38195 |
| Price | |
| Order / More Info | CXCR2/IL-8RB Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|