| Edit |   |
| Antigenic Specificity | ZBTB3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ZBTB3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZBTB3. This antibody reacts with human. The ZBTB3 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human ZBTB3. Peptide sequence EDLAKRSKPDPEVGPLLGVQPLPGSPTADRQSSSGGGPPKDFVLAPKTNI. |
| Other Names | FLJ23392, zinc finger and BTB domain containing 3, zinc finger and BTB domain-containing protein 3 |
| Gene, Accession # | ZBTB3, Gene ID: 79842, Accession: NP_079060, SwissProt: NP_079060 |
| Catalog # | NBP1-80368-20ul |
| Price | |
| Order / More Info | ZBTB3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |