| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PP2A alpha |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PP2A alpha Antibody from Novus Biologicals is a rabbit polyclonal antibody to PP2A alpha. This antibody reacts with human, mouse, rat. The PP2A alpha Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat PP2A alpha antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYF |
|---|
| Other Names | EC 3.1.3.16, PP2A-alpha, PP2Ac, PP2CA, PP2Calpha, protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform, protein phosphatase 2, catalytic subunit, alpha isozyme, protein phosphatase 2A catalytic subunit, alpha isoform, Replication protein C, RP-C, serine/threonine protein phosphatase 2A, catalytic subunit, alpha isoform, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform |
|---|
| Gene, Accession # | PPP2CA, Gene ID: 5515 |
|---|
| Catalog # | NBP2-46693 |
|---|
| Price | |
|---|
| Order / More Info | PP2A alpha Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|