| Edit |   |
| Antigenic Specificity | START domain containing 7 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The START domain containing 7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to START domain containing 7. This antibody reacts with human. The START domain containing 7 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human START domain containing 7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VIRPHKSFDENGFDYLLTYSDNPQTVFPRYCVSWMVSSGMPDFLEKLHMATLKAKNMEIKVKDYISAKPLEMSSEAKATSQSSERKNE |
| Other Names | Gestational trophoblastic tumor protein 1, GTT1stAR-related lipid transfer protein 7, mitochondrial, StARD7, StAR-related lipid transfer (START) domain containing 7, START domain containing 7, START domain-containing protein 7 |
| Gene, Accession # | STARD7, Gene ID: 56910 |
| Catalog # | NBP2-57423 |
| Price | |
| Order / More Info | START domain containing 7 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |