| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FOXI1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FOXI1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FOXI1. This antibody reacts with human. The FOXI1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human FOXI1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TSHPLVTPGLSPEPSDKTGQNSLTFNSFSPLTNLSNHSGGGDWANPMPTNMLSYGGSVLSQFSPHFYNSVNTSG |
|---|
| Other Names | FKHL10HFH3, forkhead box I1, forkhead box protein I1, forkhead-like 10, forkhead-related activator 6, Forkhead-related protein FKHL10, Forkhead-related transcription factor 6, FREAC-6, FREAC6FKH10, Hepatocyte nuclear factor 3 forkhead homolog 3, HFH-3, HNF-3/fork-head homolog 3, HNF-3/fork-head homolog-3, MGC34197 |
|---|
| Gene, Accession # | FOXI1, Gene ID: 2299 |
|---|
| Catalog # | NBP2-49660 |
|---|
| Price | |
|---|
| Order / More Info | FOXI1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|