| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FoxF1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FoxF1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FoxF1. This antibody reacts with human. The FoxF1 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GFRRKCQALKPMYSMMNGLGFNHLPDTYGFQGSAGGLSCPPNSLALEGGLGMMNGHLPGNVDGMALPSHSVPHLPSNGGHSYMGG |
|---|
| Other Names | FKHL5MGC105125, forkhead box F1, forkhead box protein F1, Forkhead, drosophila, homolog-like 5, Forkhead-related activator 1, Forkhead-related protein FKHL5, Forkhead-related transcription factor 1, FREAC-1, FREAC1ACDMPV |
|---|
| Gene, Accession # | FOXF1, Gene ID: 2294 |
|---|
| Catalog # | NBP1-84670 |
|---|
| Price | |
|---|
| Order / More Info | FoxF1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 21964066 |
|---|
| 产品资料 |
|
|