| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FoxC2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FoxC2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FoxC2. This antibody reacts with human. The FoxC2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human FoxC2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTLGESQVSGNASCQLPYRSTPPLYRHAAPYSYDCTK |
|---|
| Other Names | FKHL14LD, forkhead box C2 (MFH-1, mesenchyme forkhead 1), forkhead, Drosophila, homolog-like 14, Forkhead-related protein FKHL14, Mesenchyme fork head protein 1, mesenchyme forkhead 1, MFH-1, MFH-1 protein, MFH1forkhead box protein C2, Transcription factor FKH-14 |
|---|
| Gene, Accession # | FOXC2, Gene ID: 2303 |
|---|
| Catalog # | NBP2-58056 |
|---|
| Price | |
|---|
| Order / More Info | FoxC2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|