| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | IL-33 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF reported in the literature (PMID: 22828942). |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The IL-33 Antibody from Novus Biologicals is a rabbit polyclonal antibody to IL-33. This antibody reacts with human. The IL-33 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human IL-33 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: STVECFAFGISGVQKYTRALHDSSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDG |
|---|
| Other Names | C9orf26chromosome 9 open reading frame 26 (NF-HEV), DKFZp586H0523, DVS27, DVS27-related protein, IL1F11, IL-1F11, IL-33, interleukin 33, Interleukin-1 family member 11, interleukin-33, NFHEV, NF-HEVNFEHEV, Nuclear factor from high endothelial venules, RP11-575C20.2 |
|---|
| Gene, Accession # | IL33, Gene ID: 90865 |
|---|
| Catalog # | NBP1-86702 |
|---|
| Price | |
|---|
| Order / More Info | IL-33 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 22828942 |
|---|
| 产品资料 |
|
|