| Edit |   |
|---|
| Antigenic Specificity | CYB5R3 |
|---|
| Clone | 2A9 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | ELISA. It has been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CYB5R3 Antibody (2A9) from Novus Biologicals is a mouse monoclonal antibody to CYB5R3. This antibody reacts with human. The CYB5R3 Antibody (2A9) has been validated for the following applications: ELISA. |
|---|
| Immunogen | CYB5R3 (AAH04821.1 157 a.a. - 252 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FAIRPDKKSNPIIRTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSARFKLWYTLDRAPEAWDYGQGF |
|---|
| Other Names | B5RNADH-cytochrome b5 reductase 3, Cytochrome b5 reductase, cytochrome b5 reductase 3, DIA1NADH-cytochrome b5 reductase 3 membrane-bound form, diaphorase (NADH) (cytochrome b-5 reductase), Diaphorase-1, EC 1.6.2.2, NADH-cytochrome b5 reductase 3 soluble form |
|---|
| Gene, Accession # | CYB5R3, Gene ID: 1727, Accession: AAH04821, SwissProt: AAH04821 |
|---|
| Catalog # | H00001727-M01 |
|---|
| Price | |
|---|
| Order / More Info | CYB5R3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|