| Edit |   |
|---|
| Antigenic Specificity | CYB5R2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CYB5R2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CYB5R2. This antibody reacts with rat. The CYB5R2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the C terminal of human Cyb5r2The immunogen for this antibody is Cyb5r2. Peptide sequence WEYSSGFITADMIKEHLPPPGEATLILVCGPPPLIQEAAHPSLEQLGYTK. |
|---|
| Other Names | B5R.2, cytochrome b5 reductase 2 |
|---|
| Gene, Accession # | CYB5R2, Gene ID: 51700, Accession: NP_001014266 |
|---|
| Catalog # | NBP1-79540 |
|---|
| Price | |
|---|
| Order / More Info | CYB5R2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|