| Edit |   |
| Antigenic Specificity | ZNF319 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ZNF319 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF319. This antibody reacts with human. The ZNF319 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human ZNF319The immunogen for this antibody is ZNF319. Peptide sequence TLPPGTAENPLGCAVYGILLQPDPGLQPPQHAPLQAAGEPGPKCGVCGHD. |
| Other Names | Zinc finger and SCAN domain-containing protein 15, zinc finger protein 397, Zinc finger protein 47ZSCAN15MGC13250, ZNF47 |
| Gene, Accession # | ZNF319, Gene ID: 57567, Accession: NP_065858, SwissProt: NP_065858 |
| Catalog # | NBP1-79387 |
| Price | |
| Order / More Info | ZNF319 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |