| Edit |   |
|---|
| Antigenic Specificity | ZNF319 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZNF319 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF319. This antibody reacts with human. The ZNF319 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human ZNF319The immunogen for this antibody is ZNF319. Peptide sequence TLPPGTAENPLGCAVYGILLQPDPGLQPPQHAPLQAAGEPGPKCGVCGHD. |
|---|
| Other Names | Zinc finger and SCAN domain-containing protein 15, zinc finger protein 397, Zinc finger protein 47ZSCAN15MGC13250, ZNF47 |
|---|
| Gene, Accession # | ZNF319, Gene ID: 57567, Accession: NP_065858, SwissProt: NP_065858 |
|---|
| Catalog # | NBP1-79387-20ul |
|---|
| Price | |
|---|
| Order / More Info | ZNF319 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|