| Edit |   |
| Antigenic Specificity | ZNF658 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ZNF658 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF658. This antibody reacts with human. The ZNF658 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ZNF658 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GKCSDLNEYGTSCDKTTAVEYNKVHMAMTHYECNERGINFSRKS |
| Other Names | DKFZp572C163, FLJ32813, MGC35232, zinc finger protein 658 |
| Gene, Accession # | ZNF658, Gene ID: 26149, Accession: Q5TYW1, SwissProt: Q5TYW1 |
| Catalog # | NBP2-30748 |
| Price | |
| Order / More Info | ZNF658 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |