| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ZNF650 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZNF650 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF650. This antibody reacts with human. The ZNF650 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ZNF650 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DRSAWKHAGALKKSTCDAEKSYEVLLSFVISELFKGKLYHEEGTQECAMVNPIAWSPESMEKCLQDFCLPFLRITSLLQHHLFGEDLPSCQE |
|---|
| Other Names | DKFZp434P117, E3 ubiquitin-protein ligase UBR3, EC 6.3.2.-, FLJ37422, KIAA2024DKFZp686N10185, MGC126489, N-recognin-3, ubiquitin protein ligase E3 component n-recognin 3 (putative), Ubiquitin-protein ligase E3-alpha-3, Ubiquitin-protein ligase E3-alpha-III, Zinc finger protein 650ZNF650 |
|---|
| Gene, Accession # | UBR3, Gene ID: 130507 |
|---|
| Catalog # | NBP1-87996 |
|---|
| Price | |
|---|
| Order / More Info | ZNF650 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|