| 产品详情 |
| Edit |   |
| Antigenic Specificity | PP2C gamma/PPM1G |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PP2C gamma/PPM1G Antibody from Novus Biologicals is a rabbit polyclonal antibody to PP2C gamma/PPM1G. This antibody reacts with human, mouse, rat. The PP2C gamma/PPM1G Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. Specificity of human, mouse, rat PP2C gamma/PPM1G antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NGELRLLSSIVEELLDQCLAPDTSGDGTGCDNMTCIIICFKPRNTAELQPESGKRKLEEVLSTEGAEENGNSD |
| Other Names | EC 3.1.3.16, MGC1675, MGC2870, PP2C, gamma, PP2CG, PP2C-gamma, PP2CGAMMA, PPM1C, PPP2CG, Protein phosphatase 1C, protein phosphatase 1G, protein phosphatase 1G (formerly 2C), magnesium-dependent, gamma isoform, protein phosphatase 2, catalytic subunit, gamma isoform, protein phosphatase 2C gamma isoform, Protein phosphatase 2C isoform gamma, Protein phosphatase magnesium-dependent 1 gamma, protein phosphatase, Mg2+/Mn2+ dependent, 1G |
| Gene, Accession # | PPM1G, Gene ID: 5496 |
| Catalog # | NBP1-87246 |
| Price | |
| Order / More Info | PP2C gamma/PPM1G Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|