| 产品详情 |
| Edit |   |
| Antigenic Specificity | IL-36 beta/IL-1F8 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The IL-36 beta/IL-1F8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to IL-36 beta/IL-1F8. This antibody reacts with human. The IL-36 beta/IL-1F8 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human IL1F8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKP |
| Other Names | family of interleukin 1-eta, FIL1, FIL1 eta, FIL1-(ETA), FIL1H, FILI-(ETA), IL-1 eta, IL1-ETA, IL1F8, IL-1F8, IL1F8 (Canonical product IL-1F8a), IL-1F8 (FIL1-eta), IL1H2, IL-1H2, interleukin 1 family, member 8 (eta), interleukin 1, eta, Interleukin 36, Beta, Interleukin-1 eta, interleukin-1 family member 8, Interleukin-1 homolog 2, Interleukin-1 Superfamily e, Interleukin-36 Beta |
| Gene, Accession # | IL36B, Gene ID: 27177 |
| Catalog # | NBP1-83892 |
| Price | |
| Order / More Info | IL-36 beta/IL-1F8 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|