| Edit |   |
|---|
| Antigenic Specificity | ZNF155 |
|---|
| Clone | 2F11 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against recombinant protein on ELISA. It has been used for WB. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZNF155 Antibody (2F11) from Novus Biologicals is a mouse monoclonal antibody to ZNF155. This antibody reacts with human. The ZNF155 Antibody (2F11) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | ZNF155 (NP_003436 422 a.a. - 520 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HSGEKPYKCEECGKGYVTKFNLDLHQRVHTGERPYNCKECGKNFSRASSILNHKRLHCQKKPFKCEDCGKRLVHRTYRKDQPRDYSGENPSKCEDCGRR |
|---|
| Other Names | KRAB A domain, MGC161655, pHZ-96, zinc finger protein 155, zinc finger protein 155 (pHZ-96) |
|---|
| Gene, Accession # | ZNF155, Gene ID: 7711, Accession: NP_003436, SwissProt: NP_003436 |
|---|
| Catalog # | H00007711-M01 |
|---|
| Price | |
|---|
| Order / More Info | ZNF155 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|