| Edit |   |
| Antigenic Specificity | ZNF14 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ZNF14 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF14. This antibody reacts with human. The ZNF14 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to ZNF14(zinc finger protein 14) The peptide sequence was selected from the N terminal of ZNF14. Peptide sequence IYYQPFQRHERTHAGQKPYECKQCGKTFIYYQSFQKHAHTGKKPYECKQC. |
| Other Names | GIOT4, GIOT-4gonadotropin inducible transcription repressor-4, Gonadotropin-inducible ovary transcription repressor 4, KOX6Zinc finger protein KOX6, zinc finger protein 14, zinc finger protein 14 (KOX 6) |
| Gene, Accession # | ZNF14, Gene ID: 7561, Accession: P17017, SwissProt: P17017 |
| Catalog # | NBP1-56337 |
| Price | |
| Order / More Info | ZNF14 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |