| Edit |   |
| Antigenic Specificity | ZNF138 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ZNF138 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF138. This antibody reacts with human. The ZNF138 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the C terminal of human ZNF138The immunogen for this antibody is ZNF138. Peptide sequence IHTEEKPYKCEQCGKVFKQSPTLTKHQIIYTGEEPYKCEECGKAFNLS. |
| Other Names | pHZ-32, zinc finger protein 138, zinc finger protein 138 (clone pHZ-32) |
| Gene, Accession # | ZNF138, Gene ID: 7697, Accession: NP_006515, SwissProt: NP_006515 |
| Catalog # | NBP1-79236-20ul |
| Price | |
| Order / More Info | ZNF138 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |