| Edit |   |
|---|
| Antigenic Specificity | ZNF138 |
|---|
| Clone | 4D11 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunohistochemistry-Paraffin. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZNF138 Antibody (4D11) from Novus Biologicals is a mouse monoclonal antibody to ZNF138. This antibody reacts with human. The ZNF138 Antibody (4D11) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | ZNF138 (NP_006515.1, 151 a.a. - 251 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TNLSKPKKIHTGEKPYKCEVCGKAFHQSSILTKHKIIRTGEKPYKCAHCGKAFKQSSHLTRHKIIHTEEKPYKCEQCGKVFKQSPTLTKHQIIYTGEEPYK |
|---|
| Other Names | pHZ-32, zinc finger protein 138, zinc finger protein 138 (clone pHZ-32) |
|---|
| Gene, Accession # | ZNF138, Gene ID: 7697, Accession: NP_006515, SwissProt: NP_006515 |
|---|
| Catalog # | H00007697-M01 |
|---|
| Price | |
|---|
| Order / More Info | ZNF138 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|