| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | hHR23b |
|---|
| Clone | 3H7 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2b kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunohistochemistry-Paraffin. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The hHR23b Antibody (3H7) from Novus Biologicals is a mouse monoclonal antibody to hHR23b. This antibody reacts with human. The hHR23b Antibody (3H7) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | RAD23B (NP_002865.1 311 a.a. - 409 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PQLLQQISQHQEHFIQMLNEPVQEAGGQGGGGGGGSGGIAEAGSGHMNYIQVTPQEKEAIERLKALGFPEGLVIQAYFACEKNENLAANFLLQQNFDED |
|---|
| Other Names | HHR23B, HR23BUV excision repair protein RAD23 homolog B, p58, RAD23 (S. cerevisiae) homolog B, RAD23 homolog B (S. cerevisiae), RAD23, yeast homolog of, B, XP-C repair complementing complex 58 kDa, XP-C repair complementing protein, XP-C repair-complementing complex 58 kDa protein |
|---|
| Gene, Accession # | RAD23B, Gene ID: 5887, Accession: NP_002865, SwissProt: NP_002865 |
|---|
| Catalog # | H00005887-M10 |
|---|
| Price | |
|---|
| Order / More Info | hHR23b Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|