| 产品详情 |
| Edit |   |
| Antigenic Specificity | hHR23b |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The hHR23b Antibody from Novus Biologicals is a rabbit polyclonal antibody to hHR23b. This antibody reacts with human. The hHR23b Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human hHR23b antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAGGQGGGGGGGSGGIAEAGSGHMNYIQVTPQE |
| Other Names | HHR23B, HR23BUV excision repair protein RAD23 homolog B, p58, RAD23 (S. cerevisiae) homolog B, RAD23 homolog B (S. cerevisiae), RAD23, yeast homolog of, B, XP-C repair complementing complex 58 kDa, XP-C repair complementing protein, XP-C repair-complementing complex 58 kDa protein |
| Gene, Accession # | RAD23B, Gene ID: 5887 |
| Catalog # | NBP1-89698 |
| Price | |
| Order / More Info | hHR23b Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|