| 产品详情 |
| Edit |   |
| Antigenic Specificity | hHpr1-p84-Thoc1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization, Use PFA/Triton X-100. Western Blot verified by a customer review. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The hHpr1-p84-Thoc1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to hHpr1-p84-Thoc1. This antibody reacts with human. The hHpr1-p84-Thoc1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human hHpr1-p84-Thoc1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VFCGRIQLFLARLFPLSEKSGLNLQSQFNLENVTVFNTNEQESTLGQKHTEDREEGMDVEEGEMGDEEAPTTCSIPIDYNLYRKFWS |
| Other Names | HPR1THO complex subunit 1, hTREX84, Nuclear matrix protein p84, P84, P84N5, THO complex 1, tho1 |
| Gene, Accession # | THOC1, Gene ID: 9984 |
| Catalog # | NBP1-89669 |
| Price | |
| Order / More Info | hHpr1-p84-Thoc1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 21329510 |
| 产品资料 |
|
|