| Edit |   |
|---|
| Antigenic Specificity | HHIPL1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HHIPL1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HHIPL1. This antibody reacts with human. The HHIPL1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the C terminal of human HHIPL1The immunogen for this antibody is HHIPL1 (NP_001120730). Peptide sequence EFGQGGSLPILLDDVRCAGWERNLLECQHNGVGTHNCEHDEDAGVVCSHQ. |
|---|
| Other Names | ARAR9245, HHIP-like 1, HHIP-like protein 1, KIAA1822 |
|---|
| Gene, Accession # | HHIPL1, Gene ID: 84439, Accession: Q96JK4, SwissProt: Q96JK4 |
|---|
| Catalog # | NBP1-79777-20ul |
|---|
| Price | |
|---|
| Order / More Info | HHIPL1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|