| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TrkA |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TrkA Antibody from Novus Biologicals is a rabbit polyclonal antibody to TrkA. This antibody reacts with human. The TrkA Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human TrkA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KSGLRFVAPDAFHFTPRLSRLNLSFNALESLSWKTVQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQG |
|---|
| Other Names | DKFZp781I14186, EC 2.7.10, EC 2.7.10.1, MTChigh affinity nerve growth factor receptor, Neurotrophic tyrosine kinase receptor type 1, neurotrophic tyrosine kinase, receptor, type 1, p140-TrkA, TRK1-transforming tyrosine kinase protein, Trk-A, TRKAOncogene TRK, TRKTRK1, tyrosine kinase receptor A |
|---|
| Gene, Accession # | NTRK1, Gene ID: 4914, Accession: P04629, SwissProt: P04629 |
|---|
| Catalog # | NBP2-38265 |
|---|
| Price | |
|---|
| Order / More Info | TrkA Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|