| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TR2IT1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TR2IT1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TR2IT1. This antibody reacts with human. The TR2IT1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human TR2IT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SSLEHGDKVFGQGFPSPLEEIKRLLKISRALQARSVPSTQEKAKCLSGEPGQPEGKGQETYPGPGKVEGKAEPAMRKDDVCP |
|---|
| Other Names | Protein TXNRD3NB, Thioredoxin Reductase 2 Intronic Transcript 1, Thioredoxin Reductase 3 Intronic Transcript 1, thioredoxin reductase 3 neighbor, Thioredoxin Reductase 3 Neighbor Gene Protein, Thioredoxin Reductase 3 New Transcript 1, TXNRD3 Neighbor Gene Protein, TXNRD3IT1, TXNRD3NB, TXNRD3NT1 |
|---|
| Gene, Accession # | TXNRD3NB, Gene ID: 645840, Accession: Q6F5E7, SwissProt: Q6F5E7 |
|---|
| Catalog # | NBP2-31707 |
|---|
| Price | |
|---|
| Order / More Info | TR2IT1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|