| Edit |   |
|---|
| Antigenic Specificity | SSX7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SSX7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SSX7. This antibody reacts with human. The SSX7 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human SSX7The immunogen for this antibody is SSX7. Peptide sequence IFPKIMPKKPAEEGNDSKGVPEASGSQNDGKHLCPPGKPSTSEKINKTSG. |
|---|
| Other Names | protein SSX7, synovial sarcoma, X breakpoint 7 |
|---|
| Gene, Accession # | SSX7, Gene ID: 280658, Accession: NP_775494, SwissProt: NP_775494 |
|---|
| Catalog # | NBP1-79468-20ul |
|---|
| Price | |
|---|
| Order / More Info | SSX7 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|