| Edit |   |
|---|
| Antigenic Specificity | SSX5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Tissue Culture Substratum |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SSX5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SSX5. This antibody reacts with human. The SSX5 Antibody has been validated for the following applications: Western Blot, Tissue Culture Substratum. |
|---|
| Immunogen | The immunogen for this antibody is SSX5 - C-terminal region. Peptide sequence EGNDSKGVPEASGPQNNGKQLRPSGKLNTSEKVNKTSGPKRGKHAWTHRV. |
|---|
| Other Names | MGC9494, protein SSX5, synovial sarcoma, X breakpoint 5 |
|---|
| Gene, Accession # | SSX5, Gene ID: 6758, Accession: NP_783729, SwissProt: NP_783729 |
|---|
| Catalog # | NBP1-98335-20ul |
|---|
| Price | |
|---|
| Order / More Info | SSX5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|