| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FNTA |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FNTA Antibody from Novus Biologicals is a rabbit polyclonal antibody to FNTA. This antibody reacts with human. The FNTA Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human FNTA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LDSPSYVLYRHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADI |
|---|
| Other Names | CAAX farnesyltransferase subunit alpha, EC 2.5.1.58, EC 2.5.1.59, farnesyl-protein transferase alpha-subunit, farnesyltransferase, CAAX box, alpha, FPTA, FTase-alpha, GGTase-I-alpha, MGC99680, PGGT1A, protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha, protein prenyltransferase alpha subunit repeat containing 2, PTAR2, Ras proteins prenyltransferase subunit alpha, type I protein geranyl-geranyltransferase alpha subunit, Type I protein geranyl-geranyltransferase subunit alpha |
|---|
| Gene, Accession # | FNTA, Gene ID: 2339 |
|---|
| Catalog # | NBP1-83428 |
|---|
| Price | |
|---|
| Order / More Info | FNTA Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|