| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RSK1 |
|---|
| Clone | 2E3 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2b kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RSK1 Antibody (2E3) from Novus Biologicals is a mouse monoclonal antibody to RSK1. This antibody reacts with human. The RSK1 Antibody (2E3) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | RPS6KA1 (NP_002944 342 a.a. - 416 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VAQPDDTFYFDTEFTSRTPKDSPGIPPSAGAHQLFRGFSFVATGLMEDDGKPRAPQAPLHSVVQQLHGKNLVFSD |
|---|
| Other Names | 90kD, polypeptide 1), EC 2.7.11, EC 2.7.11.1,90 kDa ribosomal protein S6 kinase 1, HU-1, MAP kinase-activated protein kinase 1a, MAPK-activated protein kinase 1a, MAPKAP kinase 1a, MAPKAPK-1a, p90RSK1, p90S6K, ribosomal protein S6 kinase alpha 1, ribosomal protein S6 kinase alpha-1, ribosomal protein S6 kinase, 90kD, polypeptide 1, ribosomal protein S6 kinase, 90kDa, polypeptide 1, Ribosomal S6 kinase 1, RSK, RSK-1, RSK1p90-RSK 1, S6K-alpha 1, S6K-alpha-1 |
|---|
| Gene, Accession # | RPS6KA1, Gene ID: 6195, Accession: NP_002944, SwissProt: NP_002944 |
|---|
| Catalog # | H00006195-M01 |
|---|
| Price | |
|---|
| Order / More Info | RSK1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|