| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RSK1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RSK1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RSK1. This antibody reacts with human, rat. The RSK1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, rat RSK1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KMLHVDPHQRLTAKQVLQHPWVTQKDKLPQSQLSHQDLQLVKGAMAATYSALNSSKPTPQLKPIESSILAQRRVRKLPSTTL |
|---|
| Other Names | 90kD, polypeptide 1), EC 2.7.11, EC 2.7.11.1,90 kDa ribosomal protein S6 kinase 1, HU-1, MAP kinase-activated protein kinase 1a, MAPK-activated protein kinase 1a, MAPKAP kinase 1a, MAPKAPK-1a, p90RSK1, p90S6K, ribosomal protein S6 kinase alpha 1, ribosomal protein S6 kinase alpha-1, ribosomal protein S6 kinase, 90kD, polypeptide 1, ribosomal protein S6 kinase, 90kDa, polypeptide 1, Ribosomal S6 kinase 1, RSK, RSK-1, RSK1p90-RSK 1, S6K-alpha 1, S6K-alpha-1 |
|---|
| Gene, Accession # | RPS6KA1, Gene ID: 6195 |
|---|
| Catalog # | NBP1-89647 |
|---|
| Price | |
|---|
| Order / More Info | RSK1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|