| Edit |   |
| Antigenic Specificity | RSBN1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RSBN1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RSBN1. This antibody reacts with human. The RSBN1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to RSBN1 (round spermatid basic protein 1) The peptide sequence was selected from the N terminal of RSBN1)(50ug). Peptide sequence GGAVGPFKCVFVGEMAAQVGAVRVVRAVAAQEEPDKEGKEKPHAGVSPRG. |
| Other Names | DKFZp781E21150, FLJ11220, ROSBIN, round spermatid basic protein 1, RP11-324J2.1 |
| Gene, Accession # | RSBN1, Gene ID: 54665, Accession: Q5VWQ0, SwissProt: Q5VWQ0 |
| Catalog # | NBP1-57724 |
| Price | |
| Order / More Info | RSBN1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |