| 产品详情 |
| Edit |   |
| Antigenic Specificity | RRS1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RRS1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RRS1. This antibody reacts with human. The RRS1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human RRS1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EELLAKAEQDEAEKLQRITVHKELELQFDLGNLLASDRNPPTGLRCAGPTPEAELQALARDNTQLLINQ |
| Other Names | FSDR2, homolog of yeast ribosome biogenesis regulator, homolog of yeast ribosome biogenesis regulatory protein RRS1, KIAA0112ribosome biogenesis regulatory protein RRS1 homolog, ribosome biogenesis regulatory protein homolog, RRR, RRS1 ribosome biogenesis regulator homolog (S. cerevisiae) |
| Gene, Accession # | RRS1, Gene ID: 23212 |
| Catalog # | NBP2-49323 |
| Price | |
| Order / More Info | RRS1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|