| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RRP9 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RRP9 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RRP9. This antibody reacts with human. The RRP9 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to RRP9 (RRP9, small subunit (SSU) processome component, homolog (yeast)) The peptide sequence was selected from the middle region of RRP9. Peptide sequence IPRAKKGAEGKPPGHSSHVLCMAISSDGKYLASGDRSKLILIWEAQSC |
|---|
| Other Names | ribosomal RNA processing 9, small subunit (SSU) processome component, homolog(yeast), RNA, U3 small nucleolar interacting protein 2, RNU3IP2, RRP9 homolog, U3 small nucleolar ribonucleoprotein-associated 55 kDa protein, U3 small nucleolar RNA-interacting protein 2, U3 snoRNP-associated 55 kDa protein, U3 snoRNP-associated 55-kDa protein, U355K, U3-55KRRP9, small subunit (SSU) processome component, homolog |
|---|
| Gene, Accession # | RRP9, Gene ID: 9136, Accession: O43818, SwissProt: O43818 |
|---|
| Catalog # | NBP1-57217-20ul |
|---|
| Price | |
|---|
| Order / More Info | RRP9 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|