| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RRP4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RRP4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RRP4. This antibody reacts with human, mouse, rat. The RRP4 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat RRP4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SVILGNNGFIWIYPTPEHKEEEAGGFIANLEPVSLADREVISRLRNCIISLVTQRMMLYDTSILYCYEASLPHQIKDILKPEIMEEIVMETR |
|---|
| Other Names | exosome component 2Ribosomal RNA-processing protein 4, homolog of yeast RRP4 (ribosomal RNA processing 4), 3' 5' exoribonuclease(RRP4), homolog of yeast RRP4 (ribosomal RNA processing 4), 3'-5'-exoribonuclease, hRrp4p, p7, RRP4exosome complex exonuclease RRP4, Rrp4p |
|---|
| Gene, Accession # | EXOSC2, Gene ID: 23404 |
|---|
| Catalog # | NBP1-92355 |
|---|
| Price | |
|---|
| Order / More Info | RRP4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|