| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CUGBP1/CELF1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CUGBP1/CELF1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CUGBP1/CELF1. This antibody reacts with human. The CUGBP1/CELF1 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KRMAQQLQQQMQQISAASVWGNLAGLNTLGPQYLALYLQLLQQTASSGNLNTLSSLHPMGGLNAMQLQNLAA |
|---|
| Other Names | BRUNOL250 kDa nuclear polyadenylated RNA-binding protein, bruno-like 2, Bruno-like protein 2, CUG RNA-binding protein, CUG triplet repeat, RNA binding protein 1, CUG triplet repeat, RNA-binding protein 1, CUG-BP, CUG-BP- and ETR-3-like factor 1, CUGBP Elav-like family member 1, CUGBP, Elav-like family member 1, CUGBP1CUG triplet repeat RNA-binding protein 1, CUGBPCELF-1, Deadenylation factor CUG-BP, EDEN-BP, EDEN-BP homolog, embryo deadenylation element binding protein, Embryo deadenylation element-binding protein homolog, hNab50, NAB50CUG-BP1, NAPOR, nuclear polyadenylated RNA-binding protein, 50-kD, RNA-binding protein BRUNOL-2 |
|---|
| Gene, Accession # | CELF1, Gene ID: 10658 |
|---|
| Catalog # | NBP2-76536 |
|---|
| Price | |
|---|
| Order / More Info | CUGBP1/CELF1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|