| 产品详情 |
| Edit |   |
| Antigenic Specificity | CUGBP2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | Protein A purified |
| Size | 100ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CUGBP2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CUGBP2. This antibody reacts with human. The CUGBP2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
| Immunogen | Synthetic peptides corresponding to CUGBP2 (CUG triplet repeat, RNA binding protein 2) The peptide sequence was selected from the N terminal of CUGBP2. Peptide sequence VYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKTLPGMHHP. |
| Other Names | BRUNOL3ELAV-type RNA-binding protein 3, Bruno-like protein 3, CELF-2, CUG triplet repeat RNA-binding protein 2, CUG triplet repeat, RNA binding protein 2, CUG triplet repeat, RNA-binding protein 2, CUG-BP- and ETR-3-like factor 2, CUGBP Elav-like family member 2, CUGBP, Elav-like family member 2, CUG-BP2, CUGBP2hNAPOR, Etr-3, ETR3RNA-binding protein BRUNOL-3, NAPOR, NAPOR-2, Neuroblastoma apoptosis-related RNA-binding protein |
| Gene, Accession # | CELF2, Gene ID: 10659, Accession: Q96RQ6, SwissProt: Q96RQ6 |
| Catalog # | NBP1-57376 |
| Price | |
| Order / More Info | CUGBP2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|