| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CTU2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CTU2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CTU2. This antibody reacts with human. The CTU2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human CTU2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LSPDSFCLGFSEGAACGQSLEERSKTLAEVKPILQATGFPWHVVALEEVFSLPPSVLWCSAQELVGSEGAYKAAVDSFLQQQH |
|---|
| Other Names | C16orf84, chromosome 16 open reading frame 84, cytoplasmic tRNA 2-thiolation protein 2, cytosolic thiouridylase subunit 2 homolog (S. pombe), MGC131681, MGC148063, NCS2MGC148064, UPF0432 |
|---|
| Gene, Accession # | CTU2, Gene ID: 348180 |
|---|
| Catalog # | NBP1-88457 |
|---|
| Price | |
|---|
| Order / More Info | CTU2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|