| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CTU1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CTU1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CTU1. This antibody reacts with human. The CTU1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CTU1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RLGISLQLVAVDEGIGGYRDAALAAVRRQAARWELPLTVVAYEDLFGGWTMDAVARSTAGSGRSRSCCTFCGVLR |
|---|
| Other Names | ATP binding domain 3, ATPBD3cancer-associated protein, Cancer-associated gene protein, cytoplasmic tRNA 2-thiolation protein 1, Cytoplasmic tRNA adenylyltransferase 1, cytosolic thiouridylase subunit 1 homolog (S. pombe), EC 2.7.7, EC 2.7.7.-, MGC17332, NCS6ATP-binding domain-containing protein 3 |
|---|
| Gene, Accession # | CTU1, Gene ID: 90353 |
|---|
| Catalog # | NBP2-47500 |
|---|
| Price | |
|---|
| Order / More Info | CTU1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|