| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | EGLN1/PHD2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The EGLN1/PHD2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to EGLN1/PHD2. This antibody reacts with human. The EGLN1/PHD2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human EGLN1/PHD2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a Recombinant Protein corresponding to amino acids: GICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKING |
|---|
| Other Names | C1orf12HPH2, EC 1.14.11, EC 1.14.11.-, ECYT3, egl nine homolog 1, egl nine homolog 1 (C. elegans), egl nine-like protein 1, HIF prolyl hydroxylase 2, HIF-PH2, HIFPH2 EGL nine (C.elegans) homolog 1, HIF-prolyl hydroxylase 2, HPH-2, Hypoxia-inducible factor prolyl hydroxylase 2, PHD2SM20, Prolyl hydroxylase domain-containing protein 2, SM-20, zinc finger MYND domain-containing protein 6, ZMYND6DKFZp761F179 |
|---|
| Gene, Accession # | EGLN1, Gene ID: 54583 |
|---|
| Catalog # | NBP2-54676 |
|---|
| Price | |
|---|
| Order / More Info | EGLN1/PHD2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|