| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RQCD1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RQCD1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RQCD1. This antibody reacts with human. The RQCD1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human RQCD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: WHSFGTIAALLQEIVNIYPSINPPTLTAHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTS |
|---|
| Other Names | cancer/testis antigen 129, CNOT9protein involved in sexual development, CT129, rcd-1, rcd1 (required for cell differentiation, S.pombe) homolog 1, RCD1 required for cell differentiation1 homolog (S. pombe), RCD1+, RCD1cell differentiation protein RCD1 homolog |
|---|
| Gene, Accession # | RQCD1, Gene ID: 9125 |
|---|
| Catalog # | NBP1-92354 |
|---|
| Price | |
|---|
| Order / More Info | RQCD1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|