| Edit |   |
|---|
| Antigenic Specificity | CCDC170 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CCDC170 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCDC170. This antibody reacts with human. The CCDC170 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RMVSQLEAQISELVEQLGKESGFHQKALQRAQKAENMLETLQGQLTHLEAELVSGGVLRDNLNFEKQKYLKFLDQLSQKMKLDQMA |
|---|
| Other Names | bA282P11.1, C6orf97, chromosome 6 open reading frame 97, coiled-coil domain containing 170, FLJ23305, hypothetical protein LOC80129 |
|---|
| Gene, Accession # | CCDC170, Gene ID: 80129, Accession: Q8IYT3, SwissProt: Q8IYT3 |
|---|
| Catalog # | NBP2-37860 |
|---|
| Price | |
|---|
| Order / More Info | CCDC170 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|