| Edit |   |
| Antigenic Specificity | CCDC154 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CCDC154 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCDC154. This antibody reacts with human. The CCDC154 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human C16orf29 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TNQIMKLENCVQANKTIQNLRFNTEARLRTQEMATLWESVLRLWSEEGPRTPLGSWKALPSLVRPRVFIKDMAPGKVVPMN |
| Other Names | C16orf29, CCDC154, Chromosome 16 Open Reading Frame 29, Coiled-Coil Domain Containing 154, Coiled-Coil Domain-Containing Protein 154 |
| Gene, Accession # | CCDC154, Gene ID: 645811, Accession: A6NI56, SwissProt: A6NI56 |
| Catalog # | NBP2-30849 |
| Price | |
| Order / More Info | CCDC154 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |