| Edit |   |
| Antigenic Specificity | CCDC151 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CCDC151 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCDC151. This antibody reacts with human. The CCDC151 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to MGC20983 The peptide sequence was selected from the middle region of MGC20983. Peptide sequence IALPLATSKDKFFDEESEEEDNEVVTRASLKIRSQKLIESHKKHRRSRRS. |
| Other Names | coiled-coil domain containing 151, coiled-coil domain-containing protein 151, FLJ31801, MGC20983 |
| Gene, Accession # | CCDC151, Gene ID: 115948, Accession: A5D8V7, SwissProt: A5D8V7 |
| Catalog # | NBP1-56716 |
| Price | |
| Order / More Info | CCDC151 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |