| Edit |   |
| Antigenic Specificity | CCDC146 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CCDC146 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCDC146. This antibody reacts with human. The CCDC146 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to CCDC146 (coiled-coil domain containing 146) The peptide sequence was selected from the middle region of CCDC146. Peptide sequence KEIEKEWLKVLRDEEMHALAIAEKSQEFLEADNRQLPNGVYTTAEQRPNA. |
| Other Names | coiled-coil domain containing 146, KIAA1505coiled-coil domain-containing protein 146 |
| Gene, Accession # | CCDC146, Gene ID: 57639, Accession: Q8IYE0, SwissProt: Q8IYE0 |
| Catalog # | NBP1-57040-20ul |
| Price | |
| Order / More Info | CCDC146 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |