| Edit |   |
|---|
| Antigenic Specificity | CCDC138 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CCDC138 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCDC138. This antibody reacts with human. The CCDC138 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to CCDC138(coiled-coil domain containing 138) The peptide sequence was selected from the N terminal of CCDC138. Peptide sequence EPRVVKPPGQDLVVESLKSRYGLGGSCPDEYDFSNFYQSKYKRRTLTSPG. |
|---|
| Other Names | coiled-coil domain containing 138, coiled-coil domain-containing protein 138, FLJ32745 |
|---|
| Gene, Accession # | CCDC138, Gene ID: 165055, Accession: Q96M89, SwissProt: Q96M89 |
|---|
| Catalog # | NBP1-56597-20ul |
|---|
| Price | |
|---|
| Order / More Info | CCDC138 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|