| Edit |   |
|---|
| Antigenic Specificity | CCDC137 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CCDC137 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCDC137. This antibody reacts with human. The CCDC137 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human CCDC137 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RSRQEMKNPISNKKRKKAAQVTFRKTLEKEAKGEEPDIAVPKFKQRKGESDGAYIHRMQQEAQHVLFLSKNQAIRQP |
|---|
| Other Names | coiled-coil domain containing 137, coiled-coil domain-containing protein 137, MGC16597 |
|---|
| Gene, Accession # | CCDC137, Gene ID: 339230 |
|---|
| Catalog # | NBP2-55713 |
|---|
| Price | |
|---|
| Order / More Info | CCDC137 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|