| 产品详情 |
| Edit |   |
| Antigenic Specificity | POLR2C |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The POLR2C Antibody from Novus Biologicals is a rabbit polyclonal antibody to POLR2C. This antibody reacts with human, mouse, rat. The POLR2C Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat POLR2C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VEFTLDVRCNEDQTRHVTSRDLISNSPRVIPVTSRNRDNDPNDYVEQDDILIVKLRKGQELRLRAYAKKGFGKEHAKWNPTAGVAFEYDPD |
| Other Names | DNA-directed RNA polymerase II 33 kDa polypeptide, DNA-directed RNA polymerase II subunit C, DNA-directed RNA polymerase II subunit RPB3, hRPB33, hsRPB3, polymerase (RNA) II (DNA directed) polypeptide C (33kD), polymerase (RNA) II (DNA directed) polypeptide C, 33kDa, RNA polymerase II subunit 3, RNA polymerase II subunit B3, RPB3, RPB31, RPB33 |
| Gene, Accession # | POLR2C, Gene ID: 5432, Accession: P19387 |
| Catalog # | NBP1-80818 |
| Price | |
| Order / More Info | POLR2C Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|