| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CXCL8/IL-8 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CXCL8/IL-8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CXCL8/IL-8. This antibody reacts with human. The CXCL8/IL-8 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human CXCL8/IL-8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKF |
|---|
| Other Names | 3-10C, AMCF-I, C-X-C motif chemokine 8, CXCL8SCYB8, Emoctakin, GCP-1TSG-1, interleukin 8, K60, LECT, MDNCFb-ENAP, member 8, MONAPGCP1, NAP-1NAP1, Neutrophil-activating protein 1, Protein 3-10C, T cell chemotactic factor, T-cell chemotactic factor |
|---|
| Gene, Accession # | CXCL8, Gene ID: 3576, Accession: P10145, SwissProt: P10145 |
|---|
| Catalog # | NBP2-33819 |
|---|
| Price | |
|---|
| Order / More Info | CXCL8/IL-8 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25506669 |
|---|
| 产品资料 |
|
|